Iright
BRAND / VENDOR: Proteintech

Proteintech, 84763-4-RR, PACSIN2 Recombinant monoclonal antibody

CATALOG NUMBER: 84763-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PACSIN2 (84763-4-RR) by Proteintech is a Recombinant antibody targeting PACSIN2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 84763-4-RR targets PACSIN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, NIH/3T3 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information Peripheral membrane proteins of the Bin/amphiphysin/Rvs (BAR) and Fer-CIP4 homology-BAR (F-BAR) family participate in cellular membrane trafficking (PMID: 19549836). PACSIN2 (also known as syndapin-2) is a member of the protein kinase C and casein kinase substrate in neurons (PACSIN) family, which are membrane-binding proteins characterized by an amino-terminal F-BAR domain. PACSIN2 plays a role in intracellular vesicle-mediated transport. It is involved in the endocytosis of cell-surface receptors like the EGF receptor, contributing to its internalization (PMID: 23129763). PACSIN2 also has a role in caveolae membrane sculpting (PMID: 21610094). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0809 Product name: Recombinant human PACSIN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-486 aa of BC008037 Sequence: PSLNPEQLKKLQDKIEKCKQDVLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAIQ Predict reactive species Full Name: protein kinase C and casein kinase substrate in neurons 2 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC008037 Gene Symbol: PACSIN2 Gene ID (NCBI): 11252 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9UNF0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924