Iright
BRAND / VENDOR: Proteintech

Proteintech, 84818-5-RR, GOLIM4 Recombinant monoclonal antibody

CATALOG NUMBER: 84818-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GOLIM4 (84818-5-RR) by Proteintech is a Recombinant antibody targeting GOLIM4 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 84818-5-RR targets GOLIM4 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, MCF-7 cells, HT-1080 cells, L02 cells, C2C12 cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: U-2 OS, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Golgi integral membrane protein 4 (GOLIM4) is a 130-kDa membrane protein that is integrated into the cis/medial Golgi apparatus, which is a kind II Golgi protein. GOLIM4 is a Golgi protein that circulates between Golgi apparatus and endosomes, and its shuttle is pH sensitive(PMID:30068697). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34962 Product name: Recombinant human GOLIM4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 350-500 aa of NM_014498 Sequence: QVGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAEDQGIQ Predict reactive species Full Name: golgi integral membrane protein 4 Calculated Molecular Weight: 82 kDa Observed Molecular Weight: 130-140 kDa GenBank Accession Number: NM_014498 Gene Symbol: GOLIM4 Gene ID (NCBI): 27333 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O00461 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924