Iright
BRAND / VENDOR: Proteintech

Proteintech, 84824-2-RR, EZH2 Recombinant monoclonal antibody

CATALOG NUMBER: 84824-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The EZH2 (84824-2-RR) by Proteintech is a Recombinant antibody targeting EZH2 in WB, IHC, IF/ICC, ELISA, ChIP-qPCR applications with reactivity to human, mouse, rat samples 84824-2-RR targets EZH2 in WB, IHC, IF/ICC, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, Raji cells, NIH/3T3 cells, C6 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive ChIP-qPCR detected in: NCCIT cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information EZH2 (enhancer of zeste homologue 2, also known as KMT6) is a member of Polycomb group (PcG) family and encodes a histone methyl transferase that has an essential role in promoting histone H3 lysine 27 trimethylation (H3K27me3) and epigenetic gene silencing. EZH2 is important for cell proliferation and inhibition of cell differentiation, and is implicated in cancer progression. Overexpression of EZH2 is a marker of advanced and metastatic disease in many solid tumors, including prostate and breast cancer. This antibody detected EZH2 protein as a single band with a molecular weight (MW) of 91-100 kDa in multiple cell lines. The phosphorylation may result in the higher molecular weight (calculated MW as 80-86 kDa). (20935635, 21367748) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16789 Product name: Recombinant human EZH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-261 aa of BC010858 Sequence: HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT Predict reactive species Full Name: enhancer of zeste homolog 2 (Drosophila) Calculated Molecular Weight: 751 aa, 86 kDa Observed Molecular Weight: 90-102 kDa GenBank Accession Number: BC010858 Gene Symbol: EZH2 Gene ID (NCBI): 2146 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15910 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924