Proteintech, 84836-2-RR, CD3 Gamma Recombinant monoclonal antibody

Size: 20ul / 100ul The CD3 Gamma (84836-2-RR) by Proteintech is a Recombinant antibody targeting CD3 Gamma in WB, IHC, ELISA applications with reactivity to human samples 84836-2-RR targets CD3 Gamma in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, MOLT-4 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2147 Product name: Recombinant Human CD3 gamma protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-116 aa of BC113830 Sequence: QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATIS Predict reactive species Full Name: CD3g molecule, gamma (CD3-TCR complex) Calculated Molecular Weight: 182 aa, 20 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC113830 Gene Symbol: CD3 Gamma Gene ID (NCBI): 917 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P09693 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.