Iright
BRAND / VENDOR: Proteintech

Proteintech, 84880-1-RR, NDUFS2 Recombinant monoclonal antibody

CATALOG NUMBER: 84880-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The NDUFS2 (84880-1-RR) by Proteintech is a Recombinant antibody targeting NDUFS2 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 84880-1-RR targets NDUFS2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, HeLa cells, mouse heart tissue, mouse liver tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue Positive IHC detected in: human stomach cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Mitochondrial Complex I, responsible for the oxidation of NADH, is suspected to be an integral component of the O2-sensing pathway. NDUFS2 (NADH:Ubiquinone Oxidoreductase Core Subunit S2), a key subunit of complex I in the mitochondrial electron transport chain (ETC), is essential for acute oxygen-sensing and hypoxic pulmonary vasoconstriction (PMID: 30922174). Functions of NDUFS2 are associated with growth, cell-membrane integrity, ROS generation, apoptosis, necrosis, Complex I respiration, and synthesis of ATP (PMID: 33744462). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28008 Product name: Recombinant human NDUFS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 119-464 aa of BC000170 Sequence: GTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIRPPPRAQWIRVLFGEITRLLNHIMAVTTHALDLGAMTPFFWLFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLMDDIYQFSKNFSLRLDELEELLTNNRIWRNRTIDIGVVTAEEALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase) Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC000170 Gene Symbol: NDUFS2 Gene ID (NCBI): 4720 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75306 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924