Iright
BRAND / VENDOR: Proteintech

Proteintech, 84903-1-RR, MKL1/MRTF-A Recombinant monoclonal antibody

CATALOG NUMBER: 84903-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MKL1/MRTF-A (84903-1-RR) by Proteintech is a Recombinant antibody targeting MKL1/MRTF-A in WB, ELISA applications with reactivity to human samples 84903-1-RR targets MKL1/MRTF-A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Megakaryocytic leukemia 1 (MKL1), also known as myocardin-related transcription factor A (MRTF-A), is a transcriptional regulator involved in a wide range of pathophysiological processes in the cardiovascular system. MKL1 was initially identified as a co-factor for serum response factor (SRF) to regulate the transcription of contractile genes. Forced expression of MKL1 in non-muscle cells leads to robust up-regulation of contractile genes (PMID: 36587486, PMID: 37199168, PMID: 39222836). MKL1 is ubiquitously expressed and has been detected in lung, placenta, small intestine, liver, kidney, spleen, thymus, colon, muscle, heart, and brain. The molecular weight of MKL1 observed is consistent with what has been described in the literature (PMID: 34944031). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15308 Product name: Recombinant human MKL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 392-741 aa of BC115039 Sequence: KAPAATSILHKAGEVVVAFPAARLSTGPALVAAGLAPAEVVVATVASSGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMVTSPLTQLTLQASPLQILVKEEGPRAGSCCLSPGGRAELEGRDKDQMLQEKDKQIEALTRMLRQKQQLVERLKLQLEQEKRAQQPAPAPAPLGTPVKQENSFSSCQLSQQPLGPAHPFNPSLAAPATNHIDPCAVAPGPPSVVVKQEALQPEPEPVPAPQLLLGPQGPGLIKGVAPPTLITDSTGTHLVLTVTNKNADSPGLSSGSPQQPSSQPGSPAPAPSAQMDLEHPLQPLFGTPTSLLKKEPPGYEEAMSQQPKQQEN Predict reactive species Full Name: megakaryoblastic leukemia (translocation) 1 Calculated Molecular Weight: 931 aa, 99 kDa Observed Molecular Weight: 145-160 kDa GenBank Accession Number: BC115039 Gene Symbol: MKL1 Gene ID (NCBI): 57591 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q969V6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924