Proteintech, 84905-1-RR, Chk1 Recombinant monoclonal antibody

Size: 20ul / 100ul The Chk1 (84905-1-RR) by Proteintech is a Recombinant antibody targeting Chk1 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84905-1-RR targets Chk1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, Jurkat cells, A549 cells, MOLT-4 cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CHEK1(Checkpoint kinase-1) is also named as CHK1 and belongs to the protein kinase superfamily. It is implicated in a circuit in which it activates checkpoints, DNA repair and proliferating cell nuclear antigen and FANCD2 monoubiquitinylation(PMID:21389083). CHEK1 protects vertebrate cells against spontaneous chromosome missegregation and is required to sustain anaphase delay when spindle function is disrupted by taxol(PMID:17276342). It has 3 isoforms produced by alternative splicing with the molecular mass of 54 kDa, 44 kDa and 50 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22993 Product name: Recombinant human CHK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 262-476 aa of BC004202 Sequence: DRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRRNNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKVWLPAT Predict reactive species Full Name: CHK1 checkpoint homolog (S. pombe) Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC004202 Gene Symbol: Chk1 Gene ID (NCBI): 1111 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O14757 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.