Iright
BRAND / VENDOR: Proteintech

Proteintech, 84913-1-RR, IMPDH1 Recombinant monoclonal antibody

CATALOG NUMBER: 84913-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IMPDH1 (84913-1-RR) by Proteintech is a Recombinant antibody targeting IMPDH1 in WB, ELISA applications with reactivity to human samples 84913-1-RR targets IMPDH1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, HeLa cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information IMPDH1(Inosine-5'-monophosphate dehydrogenase 1) is also named as IMPD1, IMP dehydrogenase 1 and belongs to the IMPDH/GMPR family. It catalyzes the rate limiting step of de novo guanine synthesis and an important target for the development of drugs with both chemotherapeutic and immunosuppressive activity. It may also have a role in the development of malignancy and the growth progression of some tumors. This protein has some isoforms produced by alternative splicing with the molecular mass of 53-65 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17473 Product name: Recombinant human IMPDH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 170-235 aa of BC033622 Sequence: LSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELV Predict reactive species Full Name: IMP (inosine monophosphate) dehydrogenase 1 Calculated Molecular Weight: 563 aa, 60 kDa Observed Molecular Weight: 53-60 kDa GenBank Accession Number: BC033622 Gene Symbol: IMPDH1 Gene ID (NCBI): 3614 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20839 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924