Iright
BRAND / VENDOR: Proteintech

Proteintech, 84919-6-RR, CSF1R/CD115 Recombinant monoclonal antibody

CATALOG NUMBER: 84919-6-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CSF1R/CD115 (84919-6-RR) by Proteintech is a Recombinant antibody targeting CSF1R/CD115 in WB, IHC, ELISA applications with reactivity to mouse samples 84919-6-RR targets CSF1R/CD115 in WB, IHC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: J774A.1 cells, RAW 264.7 cells, mouse spleen tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CSF1R (colony-stimulating factor 1 receptor) belongs to the type III protein tyrosine kinase receptor family. CSF1R-mediated signaling is crucial for the differentiation and survival of the mononuclear phagocyte system and macrophages in particular (PMID: 28716061). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1816 Product name: Recombinant Mouse CSF1R protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-511 aa of NM_001037859.2 Sequence: APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES Predict reactive species Full Name: colony stimulating factor 1 receptor Calculated Molecular Weight: 109 kDa Observed Molecular Weight: 110-170 kDa GenBank Accession Number: NM_001037859.2 Gene Symbol: CSF1R/CD115 Gene ID (NCBI): 12978 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09581 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924