Iright
BRAND / VENDOR: Proteintech

Proteintech, 84939-3-RR, SSBP1 Recombinant monoclonal antibody

CATALOG NUMBER: 84939-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SSBP1 (84939-3-RR) by Proteintech is a Recombinant antibody targeting SSBP1 in WB, IHC, ELISA applications with reactivity to human samples 84939-3-RR targets SSBP1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, A549 cells, Caco-2 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information SSBP1 is a housekeeping gene involved in mitochondrial biogenesis. it binds preferentially and cooperatively to ss-DNA in the maintainance of genome stability. SSBP1 acted as a homotetramer to stabilize the displaced single strand of the normal and expanded displacement loop (D loop) during mtDNA replication, thus preventing formation of secondary single-stranded DNA structures, which could stop the gamma-DNA polymerase. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2860 Product name: Recombinant human SSBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC000895 Sequence: MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE Predict reactive species Full Name: single-stranded DNA binding protein 1 Calculated Molecular Weight: 148 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC000895 Gene Symbol: SSBP1 Gene ID (NCBI): 6742 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q04837 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924