Iright
BRAND / VENDOR: Proteintech

Proteintech, 84960-4-RR, PTH Recombinant monoclonal antibody

CATALOG NUMBER: 84960-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PTH (84960-4-RR) by Proteintech is a Recombinant antibody targeting PTH in WB, ELISA applications with reactivity to human samples 84960-4-RR targets PTH in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Recombinant protein Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Parathyroid hormone (PTH) is a crucial hormone secreted by the parathyroid glands. The main function of PTH is to regulate calcium and phosphorus metabolism in vertebrates. It increases blood calcium levels and decreases blood phosphorus levels. PTH also plays a role in maintaining bone health and is involved in the regulation of vitamin D metabolism. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3191 Product name: Recombinant Human PTH protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-115 aa of NM_000315.4 Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ Predict reactive species Full Name: parathyroid hormone Calculated Molecular Weight: 13kDa GenBank Accession Number: NM_000315.4 Gene Symbol: PTH Gene ID (NCBI): 5741 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01270 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924