Iright
BRAND / VENDOR: Proteintech

Proteintech, 84962-4-RR, GOSR2/Membrin Recombinant monoclonal antibody

CATALOG NUMBER: 84962-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GOSR2/Membrin (84962-4-RR) by Proteintech is a Recombinant antibody targeting GOSR2/Membrin in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 84962-4-RR targets GOSR2/Membrin in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, L02 cells, mouse liver tissue, rat liver tissue, human placenta tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Golgi SNAP receptor complex member 2 (GOSR2), also known as GS27 or Membrin, is a member of the soluble NSF attachment protein receptor (SNARE) family of vesicle docking proteins. GOSR2 is localized in the Golgi apparatus. It is involved in the transport of proteins from the cis/medial-Golgi to the trans-Golgi network. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2736 Product name: Recombinant human GOSR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC009710 Sequence: MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYF Predict reactive species Full Name: golgi SNAP receptor complex member 2 Calculated Molecular Weight: 212 aa, 25 kDa Observed Molecular Weight: 23-25 kDa GenBank Accession Number: BC009710 Gene Symbol: Membrin Gene ID (NCBI): 9570 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O14653 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924