Iright
BRAND / VENDOR: Proteintech

Proteintech, 84969-4-RR, RAD50 Recombinant monoclonal antibody

CATALOG NUMBER: 84969-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RAD50 (84969-4-RR) by Proteintech is a Recombinant antibody targeting RAD50 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 84969-4-RR targets RAD50 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, MCF-7 cells, Jurkat cells, MOLT-4 cells, C6 cells Positive IHC detected in: human placenta tissue, human stomach cancer tissue, mouse brain tissue, mouse lung tissue, mouse stomach tissue, rat brain tissue, rat lung tissue, rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information RAD50 belongs to the ABC-ATPase protein family that concurs in forming the Nucleotide Binding Domain (NBD). ATP binding to Rad50 induces a conformational change that dramatically increases the Rad50 NBD affinity for itself, allowing for its dimerization (PMID: 37569756). The Mre11-Rad50 (MR) complex has key functions in the detection, signaling and repair of DNA breaks (PMID: 35501303). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29949 Product name: Recombinant human RAD50 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 275-425 aa of NM_005732 Sequence: LDSRKKQMEKDNSELEEKMEKVFQGTDEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRHQEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLVRERQEGEAKTANQLMNDFAEKETLK Predict reactive species Full Name: RAD50 homolog (S. cerevisiae) Calculated Molecular Weight: 154 kDa Observed Molecular Weight: 154 kDa GenBank Accession Number: NM_005732 Gene Symbol: RAD50 Gene ID (NCBI): 10111 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92878 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924