Iright
BRAND / VENDOR: Proteintech

Proteintech, 84977-1-RR, SPOCK1 Recombinant monoclonal antibody

CATALOG NUMBER: 84977-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SPOCK1 (84977-1-RR) by Proteintech is a Recombinant antibody targeting SPOCK1 in WB, IHC, ELISA applications with reactivity to human samples 84977-1-RR targets SPOCK1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells, PC-3 eclls, HEK-293T cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SPOCK1, also known as TICN1. It is predicted to be located in the extracellular matrix. The proein may play a role in cell-cell and cell-matrix interactions and may contribute to various neuronal mechanisms in the central nervous system. The molecular weight of SPOCK1 is 49 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28204 Product name: Recombinant human SPOCK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-236 aa of BC030691 Sequence: CVTQDYQTALCVSRKHLLPRQKKGNVAQKHWVGPSNLVKCKPCPVAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLATLCDGPCPCLPEPEPPKHKAERSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSNTAQGR Predict reactive species Full Name: sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 1 Calculated Molecular Weight: 439 aa, 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC030691 Gene Symbol: SPOCK1 Gene ID (NCBI): 6695 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q08629 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924