Iright
BRAND / VENDOR: Proteintech

Proteintech, 84985-1-RR, DSC2 Recombinant monoclonal antibody

CATALOG NUMBER: 84985-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The DSC2 (84985-1-RR) by Proteintech is a Recombinant antibody targeting DSC2 in IF/ICC, ELISA applications with reactivity to human samples 84985-1-RR targets DSC2 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: Caco-2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information Desmocollin 2 (DSC2) is a member of the desmocollin subfamily of the cadherin superfamily. The desmocollins (DSC1-3), along with the desmogleins (DSG1-4), are found primarily in epithelial and cardiac muscle where they constitute the adhesive proteins of the intercellular desmosome junctions and are required for cell adhesion and desmosome formation. Mutations in the DSC2 gene are associated with arrhythmogenic right ventricular dysplasia-11. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4956 Product name: Recombinant human DSC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-357 aa of BC063291 Sequence: LIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTR Predict reactive species Full Name: desmocollin 2 Calculated Molecular Weight: 100 kDa GenBank Accession Number: BC063291 Gene Symbol: Desmocollin 2 Gene ID (NCBI): 1824 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q02487 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924