Iright
BRAND / VENDOR: Proteintech

Proteintech, 84991-4-RR, TRMT10C Recombinant monoclonal antibody

CATALOG NUMBER: 84991-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TRMT10C (84991-4-RR) by Proteintech is a Recombinant antibody targeting TRMT10C in WB, ELISA applications with reactivity to human, rat samples 84991-4-RR targets TRMT10C in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HepG2 cells, K-562 cells, PC-12 cells, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information tRNA methyltransferase 10 homolog C (TRMT10C, also known as MRPP1) is involved in mitochondrial RNA processing and modification (PMID: 21593607). It is essential for the 5'-ends processing of mitochondrial tRNAs and plays a critical role in mitochondrial respiration and translation (PMID: 18984158; 29040705). Mutations in TRMT10C may be a cause of mitochondrial disease and highlight the importance of RNA processing for correct mitochondrial function (PMID: 27132592). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30642 Product name: Recombinant human TRMT10C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-178 aa of NM_017819 Sequence: MSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATREFIEMWRLLGREVPEHITEEELKTLMECVSNTAKKKYLKYLYTKEKVKKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFL Predict reactive species Full Name: RNA (guanine-9-) methyltransferase domain containing 1 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: NM_017819 Gene Symbol: TRMT10C Gene ID (NCBI): 54931 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q7L0Y3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924