Iright
BRAND / VENDOR: Proteintech

Proteintech, 85074-4-RR, NME2 Recombinant monoclonal antibody

CATALOG NUMBER: 85074-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The NME2 (85074-4-RR) by Proteintech is a Recombinant antibody targeting NME2 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 85074-4-RR targets NME2 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, U-87 MG cells, OVCAR-3 cells, rat kidney tissue, rat liver tissue, mouse kidney tissue, mouse liver tissue Positive IF/ICC detected in: Jurkat cells Positive FC (Intra) detected in: HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.13 ug per 10^6 cells in a 100 µl suspension Background Information NME2(non-metastatic cells 2, protein) is also named as NDKB(Nucleoside diphosphate kinase B), NM23B and belongs to the NDK family. It is involved in the phosphorylation of nucleoside diphosphates and interacts with membrane receptor and constituting a novel molecular regulatory mechanism of GPCR endocytosis. Refer to the epitope and protein detection, this antibody specifically recognizes NME2. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13913 Product name: Recombinant human NME2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC002476 Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE Predict reactive species Full Name: non-metastatic cells 2, protein (NM23B) expressed in Calculated Molecular Weight: 152 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC002476 Gene Symbol: NME2 Gene ID (NCBI): 4831 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P22392 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924