Proteintech, 85084-1-RR, ZP3 Recombinant monoclonal antibody

Size: 20ul / 100ul The ZP3 (85084-1-RR) by Proteintech is a Recombinant antibody targeting ZP3 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 85084-1-RR targets ZP3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, A549 cells, HepG2 cells, PC-3 cells Positive IHC detected in: mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse ovary tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Background Information Zona pellucida (ZP) is an extracellular matrix that surrounds the oocyte and early embryo, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy. Mammalian ZP consists of three to four glycoproteins, called ZP1, ZP2, ZP3, ZP4. ZP3 (zona pellucida glycoprotein 3, also known as zona pellucida sperm-binding protein 3) is essential for sperm binding and zona matrix formation. Human ZP3 gene encodes predicted precursor protein of 47 kDa that is processed into mature glycoprotein with larger apparent molecular mass (PMID: 8588935; 10341000). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15791 Product name: Recombinant human ZP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC113949 Sequence: MVMVSKDLFGTGKLIRAADLTLGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRPVGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTFSLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPTPDQNASPYHTIVDFHGCLVDGLTDASSAF Predict reactive species Full Name: zona pellucida glycoprotein 3 (sperm receptor) Calculated Molecular Weight: 373 aa, 41 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC113949 Gene Symbol: ZP3 Gene ID (NCBI): 7784 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P21754 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.