Iright
BRAND / VENDOR: Proteintech

Proteintech, 85096-1-RR, PPAT Recombinant monoclonal antibody

CATALOG NUMBER: 85096-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PPAT (85096-1-RR) by Proteintech is a Recombinant antibody targeting PPAT in WB, ELISA applications with reactivity to human samples 85096-1-RR targets PPAT in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells, LNCaP cells, HEK-293 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information PPAT, also known as ATase (amidophosphoribosyltransferase) or GPAT (glutamine phosphoribosylpyrophosphate amidotransferase) is the rate-limiting enzyme in the de novo pathway of purine ribonucleotide synthesis and is regulated by feedback inhibition by AMP and GMP. PPAT expression modulates pyruvate kinase activity, cell proliferation and invasion (PMID: 26140362). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7618 Product name: Recombinant human PPAT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 178-517 aa of BC004200 Sequence: KEAPTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFCIFEYVYFARPDSMFEDQMVYTVRYRCGQQLAIEAPVDADLVSTVPESATPAALAYAGKCGLPYVEVLCKNRYVGRTFIQPNMRLRQLGVAKKFGVLSDNFKGKRIVLVDDSIVRGNTISPIIKLLKESGAKEVHIRVASPPIKYPCFMGINIPTKEELIANKPEFDHLAEYLGANSVVYLSVEGLVSSVQEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW Predict reactive species Full Name: phosphoribosyl pyrophosphate amidotransferase Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC004200 Gene Symbol: PPAT Gene ID (NCBI): 5471 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q06203 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924