Proteintech, 85110-4-RR, SEC13 Recombinant monoclonal antibody

Size: 20ul / 100ul The SEC13 (85110-4-RR) by Proteintech is a Recombinant antibody targeting SEC13 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85110-4-RR targets SEC13 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, HepG2 cells, A431 cells, RAW 264.7 cells, mouse pancreas tissue, rat pancreas tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information SEC13 is a component of the nuclear pore complex (NPC) and the COPII coat. It is required for esicle biogenesis from endoplasmic reticulum during the transport of proteins. Shuttling of SEC13 between the nucleus and the cytoplasm may couple and regulate functions between these two compartments. (PMID: 14517296; 16407955) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7610 Product name: Recombinant human SEC13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-325 aa of BC002634 Sequence: MGKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ Predict reactive species Full Name: SEC13 homolog (S. cerevisiae) Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC002634 Gene Symbol: SEC13 Gene ID (NCBI): 6396 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P55735 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.