Iright
BRAND / VENDOR: Proteintech

Proteintech, 85122-4-RR, GYS2 Recombinant monoclonal antibody

CATALOG NUMBER: 85122-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GYS2 (85122-4-RR) by Proteintech is a Recombinant antibody targeting GYS2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85122-4-RR targets GYS2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:25000-1:100000 Background Information GYS2 (Glycogen Synthase 2) is a key enzyme involved in the synthesis of glycogen in the liver. It catalyzes the addition of glucose molecules to the growing glycogen chain, playing a crucial role in maintaining glucose homeostasis. GYS2 is essential for liver glycogen synthesis, which acts as a critical energy reserve for maintaining blood glucose levels, especially during fasting or prolonged exercise. Impairment of GYS2 function can lead to glycogen storage disease type 0 (GSD-0), characterized by hypoglycemia and liver glycogen deficiency. The GYS2 is highest expressed in the liver, and its expression in liver was significantly higher than other tissues. (PMID:39150597; PMID:37574425) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18012 Product name: Recombinant human GYS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 604-703 aa of BC126310 Sequence: YYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN Predict reactive species Full Name: glycogen synthase 2 (liver) Calculated Molecular Weight: 703 aa, 81 kDa Observed Molecular Weight: 81 kDa GenBank Accession Number: BC126310 Gene Symbol: GYS2 Gene ID (NCBI): 2998 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P54840 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924