Proteintech, 85129-5-RR, TCL1A Recombinant monoclonal antibody

Size: 20ul / 100ul The TCL1A (85129-5-RR) by Proteintech is a Recombinant antibody targeting TCL1A in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 85129-5-RR targets TCL1A in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Ramos cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Ramos cells Positive FC (Intra) detected in: Ramos cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information TCL1A, also named as TCL1 and p14 TCL1, enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival. TCL1A immunodetection is an independent marker of adverse outcome that could be used in routine settings for the management of DLCL patients. TCL1A expression is correlated with shorter time to treatment in chronic lymphocytic leukemia cases and shorter lymphoma-specific survival in mantle cell lymphoma series. It is a potential therapeutic target. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0786 Product name: Recombinant human TCL1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC005831 Sequence: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD Predict reactive species Full Name: T-cell leukemia/lymphoma 1A Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC005831 Gene Symbol: TCL1A Gene ID (NCBI): 8115 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P56279 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.