Iright
BRAND / VENDOR: Proteintech

Proteintech, 85137-4-RR, RNF128 Recombinant monoclonal antibody

CATALOG NUMBER: 85137-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RNF128 (85137-4-RR) by Proteintech is a Recombinant antibody targeting RNF128 in WB, ELISA applications with reactivity to human samples 85137-4-RR targets RNF128 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 205 cells, HT-29 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information RNF128 (Ring Finger Protein 128), also known as GRAIL (Gene Related to Anergy in Lymphocytes), is an E3 ubiquitin ligase that plays key roles in immune regulation, tumor biology, and antiviral responses. Initially identified in T cells, it is highly expressed in anergic CD4+ T cells and contributes to the induction and maintenance of T-cell anergy by catalyzing the ubiquitination and degradation of critical T-cell signaling molecules such as CD40L, CD80, and Rho-family GTPases. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22834 Product name: Recombinant human RNF128 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 333-428 aa of BC063404 Sequence: DGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETAVREIKS Predict reactive species Full Name: ring finger protein 128 Calculated Molecular Weight: 428 aa, 47 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC063404 Gene Symbol: RNF128 Gene ID (NCBI): 79589 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8TEB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924