Product Description
Size: 20ul / 100ul
The C1orf77 (85147-3-RR) by Proteintech is a Recombinant antibody targeting C1orf77 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
85147-3-RR targets C1orf77 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HeLa cells, Jurkat cells, HEK-293T cells, THP-1 cells
Positive IHC detected in: human colon cancer tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: SH-SY5Y cells, HeLa cells, A431 cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Immunohistochemistry (IHC): IHC : 1:200-1:800
Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag26580 Product name: Recombinant human C1orf77 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC002733 Sequence: MSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND Predict reactive species
Full Name: chromosome 1 open reading frame 77
Calculated Molecular Weight: 248 aa, 26 kDa
Observed Molecular Weight: 26-30 kDa
GenBank Accession Number: BC002733
Gene Symbol: C1orf77
Gene ID (NCBI): 26097
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q9Y3Y2
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924