Iright
BRAND / VENDOR: Proteintech

Proteintech, 85150-4-RR, TORC2 Recombinant monoclonal antibody

CATALOG NUMBER: 85150-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TORC2 (85150-4-RR) by Proteintech is a Recombinant antibody targeting TORC2 in WB, FC (Intra), ELISA applications with reactivity to human samples 85150-4-RR targets TORC2 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, Jurkat cells, Raji cells, A-673 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CRTC2, also named as TORC2, belongs to the TORC family. It is a transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. It acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. CRTC2 enhances the interaction of CREB1 with TAF4. Ir regulates gluconeogenesis as a component of the LKB1/AMPK/TORC2 signaling pathway. CRTC2 regulates the expression of specific genes such as the steroidogenic gene, StAR. TORC2 was recently shown to be an important regulator of gluconeogenesis in the livers of mammals. It is one of the other key regulators of CRE-dependent MIE gene expression in NT2 cells. This regulation is linked to VIP-induced TORC2 dephosphorylation and translocation to the nucleus. (PMID: 19369332, 20504934 ) . Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3167 Product name: Recombinant human CRTC2,TORC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 394-693 aa of BC053562 Sequence: APALSSSSSSSSTSSPVLGAPSYPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ Predict reactive species Full Name: CREB regulated transcription coactivator 2 Calculated Molecular Weight: 693 aa, 73 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC053562 Gene Symbol: TORC2 Gene ID (NCBI): 200186 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q53ET0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924