Iright
BRAND / VENDOR: Proteintech

Proteintech, 85157-4-RR, DNAJC7 Recombinant monoclonal antibody

CATALOG NUMBER: 85157-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The DNAJC7 (85157-4-RR) by Proteintech is a Recombinant antibody targeting DNAJC7 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 85157-4-RR targets DNAJC7 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, A549 cells, HEK-293 cells, Jurkat cells, mouse testis tissue, rat testis tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information DnaJC7, otherwise referred to as Tpr2 or CCRP, is a conserved, type of J protein that is highly expressed within the brain. DnaJC7 has been found to modulate the flow of substrates from Hsp70 to Hsp90, providing a control mechanism in proteins such as glucocorticoids and progesterone receptor. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1572 Product name: Recombinant human DNAJC7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-494 aa of BC011837 Sequence: YEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG Predict reactive species Full Name: DnaJ (Hsp40) homolog, subfamily C, member 7 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC011837 Gene Symbol: DNAJC7 Gene ID (NCBI): 7266 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99615 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924