Iright
BRAND / VENDOR: Proteintech

Proteintech, 85160-2-RR, IRF9 Recombinant monoclonal antibody

CATALOG NUMBER: 85160-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IRF9 (85160-2-RR) by Proteintech is a Recombinant antibody targeting IRF9 in WB, IHC, ELISA applications with reactivity to human samples 85160-2-RR targets IRF9 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, THP-1 cells, A549 cells Positive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information IRF9 also named ISGF3 is a transcription regulatory factor that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of IFN stimulated genes, which drive the cell in an antiviral state. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5365 Product name: Recombinant human IRF9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-393 aa of BC035716 Sequence: MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV Predict reactive species Full Name: IRF 9 Calculated Molecular Weight: 393 aa, 44 kDa Observed Molecular Weight: 44-48 kDa GenBank Accession Number: BC035716 Gene Symbol: IRF9 Gene ID (NCBI): 10379 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q00978 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924