Proteintech, 85182-1-RR, Glycophorin A/CD235a Recombinant monoclonal antibody

Size: 20ul / 100ul The Glycophorin A/CD235a (85182-1-RR) by Proteintech is a Recombinant antibody targeting Glycophorin A/CD235a in WB, IHC, ELISA applications with reactivity to human samples 85182-1-RR targets Glycophorin A/CD235a in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:10000-1:40000 Background Information Glycophorin A (GYPA), also known as CD235a, is the major transmembrane sialoglycoprotein in erythrocytes. It is a dimeric type I transmembrane protein carrying 15 closely clustered O-linked tetrasaccharides capped with sialic acid/N-acetylneuraminic acid (Neu5Ac). Glycophorin A represents the major sialoglycoprotein of the red blood cell membrane displaying about one million copies per cell. (PMID: 9490702) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2336 Product name: Recombinant Human Glycophorin A protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-91 aa of BC005319 Sequence: SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE Predict reactive species Full Name: glycophorin A (MNS blood group) Calculated Molecular Weight: 150 aa, 16 kDa Observed Molecular Weight: 35-38 kDa GenBank Accession Number: BC005319 Gene Symbol: Glycophorin A Gene ID (NCBI): 2993 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02724 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.