Iright
BRAND / VENDOR: Proteintech

Proteintech, 85187-1-RR, NDUFA5 Recombinant monoclonal antibody

CATALOG NUMBER: 85187-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The NDUFA5 (85187-1-RR) by Proteintech is a Recombinant antibody targeting NDUFA5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85187-1-RR targets NDUFA5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue, HepG2 cells, HEK-293 cells, rat brain tissue, mouse heart tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NDUFA5, also named as CI-13kD-B and NDUA5, belongs to the complex I NDUFA5 subunit family. It is accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which functions in the transfer of electrons from NADH to the respiratory chain. NDUFA5,an enrichment of mitochondrial protein, can be used as a mitochondrial marker protein(PMID:21360670). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9995 Product name: Recombinant human NDUFA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC000813 Sequence: MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC000813 Gene Symbol: NDUFA5 Gene ID (NCBI): 4698 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16718 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924