Iright
BRAND / VENDOR: Proteintech

Proteintech, 85188-4-RR, NSMCE2 Recombinant monoclonal antibody

CATALOG NUMBER: 85188-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The NSMCE2 (85188-4-RR) by Proteintech is a Recombinant antibody targeting NSMCE2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 85188-4-RR targets NSMCE2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, K-562 cells, A549 cells, U2OS cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information NSMCE2 (E3 SUMO-protein ligase NSE2) has a C-terminal Siz/PIAS-RING (SP-RING) domain with E3 SUMO ligase activity (PMID: 15601841). NSMCE2, an essential SUMO ligase of the SMC5/6 complex suppresses cancer and aging in mice (PMID: 26443207). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4545 Product name: Recombinant human NSMCE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-247 aa of BC032797 Sequence: MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE Predict reactive species Full Name: non-SMC element 2, MMS21 homolog (S. cerevisiae) Calculated Molecular Weight: 247 aa, 28 kDa Observed Molecular Weight: 28-32 kDa GenBank Accession Number: BC032797 Gene Symbol: NSMCE2 Gene ID (NCBI): 286053 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96MF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924