Iright
BRAND / VENDOR: Proteintech

Proteintech, 85211-4-RR, MMP8 Recombinant monoclonal antibody

CATALOG NUMBER: 85211-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MMP8 (85211-4-RR) by Proteintech is a Recombinant antibody targeting MMP8 in WB, IHC, ELISA applications with reactivity to rat samples 85211-4-RR targets MMP8 in WB, IHC, ELISA applications and shows reactivity with rat samples. Tested Applications Positive WB detected in: rat lung tissue, rat liver tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information MMP8(Matrix metalloproteinase-8) an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells(PMID:15367487). Purified human neutrophil MMP-8 with proeMMP-8 at 70-75 KDa and active enzyme at 65 KDa and amniochorion proenzyme and active enzyme at 65 and 50 KDa, respectively(PMID: 28772283, PMID:15042023). Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3278 Product name: Recombinant Rat MMP-8 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-466 aa of NM_022221.1 Sequence: LPVPPEHLEEKNMKTAENYLRKFYHLPSNQFRSARNATMIAEKLKEMQRFFGLPETGKPDAATIEIMEKPRCGVPDSGDFLLTPGSPKWTHTNLTYRIINHTPQMSKAEVKTEIEKAFKIWSVPSTLTFTETLEGEADINIAFVSRDHGDNSPFDGPNGILAHAFQPGRGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNYAYREPSTYSLPQDDINGIQTIYGPSDNPVQPTGPSTPTACDPHLRFDAATTLRGEIYFFKDKYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSAYDLQQGYPRDISNYGFPRSVQAIDAAVSYNGKTYFFVNNQCWRYDNQRRSMDPGYPTSIASVFPGINCRIDAVFQQDSFFLFFSGPQYFAFNLVSRRVTRVARSNLWLNCP Predict reactive species Full Name: matrix metallopeptidase 8 Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: NM_022221.1 Gene Symbol: Mmp8 Gene ID (NCBI): 63849 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O88766 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924