Iright
BRAND / VENDOR: Proteintech

Proteintech, 85212-2-RR, TRX2/TXN2 Recombinant monoclonal antibody

CATALOG NUMBER: 85212-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TRX2/TXN2 (85212-2-RR) by Proteintech is a Recombinant antibody targeting TRX2/TXN2 in WB, ELISA applications with reactivity to human, mouse, monkey samples 85212-2-RR targets TRX2/TXN2 in WB, ELISA applications and shows reactivity with human, mouse, monkey samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Raji cells, L02 cells, C2C12 cells, COS-7 cells, Vero cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information TXN2 (Thioredoxin-2) is also named as TRX2, MTRX, Mt-TRX, and regulates the mitochondrial redox state and plays an important role in cell proliferation. It has been shown that cells conditionally deficient in Trx2 undergo apoptosis in the absence of exogenous stress, accompanied by an accumulation of intracellular ROS, the activation of caspase 9 and caspase 3, and the release of cytochrome c into the cytosol. (PMID: 18441302). Specification Tested Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3640 Product name: Recombinant human TRX2,TXN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC013726 Sequence: MAQRLLLRRFLASVISRKPSQGQWPPLTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKLIG Predict reactive species Full Name: thioredoxin 2 Calculated Molecular Weight: 166 aa, 18 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC013726 Gene Symbol: Thioredoxin 2 Gene ID (NCBI): 25828 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99757 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924