Iright
BRAND / VENDOR: Proteintech

Proteintech, 85217-4-RR, Plakophilin 1 Recombinant monoclonal antibody

CATALOG NUMBER: 85217-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Plakophilin 1 (85217-4-RR) by Proteintech is a Recombinant antibody targeting Plakophilin 1 in WB, ELISA applications with reactivity to human, mouse samples 85217-4-RR targets Plakophilin 1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse skin tissue, HEK-293 cells, A431 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Plakophilin 1, also known as PKP1, B6P, is a member of the arm-repeat protein family. PKP1 contains arm-repeat (armadillo) domains, localizes to nuclei and cell desmosomes, and participates in linking cadherins to intermediate filaments in the cytoskeleton (PMID: 10747098). PKP1 contributes to epidermal morphogenesis and facilitates the formation of intermediate filaments. Mutations in PKP1 have been associated with the ectodermal dysplasia/skin fragility syndrome (PubMed:9326952, 10852826). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18153 Product name: Recombinant human PKP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 412-726 aa of BC114571 Sequence: NLSSADAGRQTMRNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEVPTRYRQLEYNARNAYTEKSSTGCFSNKSDKMMNNNYDCPLPEEETNPKGSGWLYHSDAIRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPQIARLLQSGNSDVVRSGASLLSNMSRHPLLHRVMGNQVFPEVTRLLTSHTGNTSNSEDILSSACYTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKAAEAARLLLSDMWSSKELQGVLRQQGFDRNMLGTLAGANSLRNFTSRF Predict reactive species Full Name: plakophilin 1 (ectodermal dysplasia/skin fragility syndrome) Calculated Molecular Weight: 747 aa, 83 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC114571 Gene Symbol: PKP1 Gene ID (NCBI): 5317 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13835 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924