Proteintech, 85347-1-RR, RIT1 Recombinant monoclonal antibody

Size: 20ul / 100ul The RIT1 (85347-1-RR) by Proteintech is a Recombinant antibody targeting RIT1 in WB, ELISA applications with reactivity to human, mouse samples 85347-1-RR targets RIT1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, mouse kidney tissue, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information RIT1 (Ras-like without CAAX protein 1) is also named as RIBB, ROC1 and GTP-binding protein Rit1. RIT1 serves as a regulatory factor for neuronal cell proliferation, survival, and differentiation (PMID: 28007959). Rit1 mediates oxidative stress resistance, contributing to cell survival via the p38 MAPK signaling pathway (PMID: 21737674). As a small G protein of Ras family, RIT1 plays a critical role in various tumors (such as hepatocellular carcinoma, HCC) (PMID: 38017479). It is worth noting that RIT1 is frequently amplified in various human cancers including HCC, lung adenocarcinoma, cholangiocarcinoma, uterine carcinosarcoma, breast cancer, and ovarian cancer (PMID: 38017479). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25636 Product name: Recombinant human RIT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-219 aa of BC104186 Sequence: QLRQVTKEEGLALAREFSCPFFETSAAYRYYIDDVFHALVREIRRKEKEAVLAMEKKSKPKNSVWKRLKSPFRKKKDSVT Predict reactive species Full Name: Ras-like without CAAX 1 Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC104186 Gene Symbol: RIT1 Gene ID (NCBI): 6016 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92963 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.