Proteintech, 85349-1-RR, AGER/RAGE Recombinant monoclonal antibody

Size: 20ul / 100ul The AGER/RAGE (85349-1-RR) by Proteintech is a Recombinant antibody targeting AGER/RAGE in WB, ELISA applications with reactivity to human, mouse, pig samples 85349-1-RR targets AGER/RAGE in WB, ELISA applications and shows reactivity with human, mouse, pig samples.

Tested Applications Positive WB detected in: mouse lung tissue, pig lung tissue Recommended dilution Western Blot (WB): WB : 1:2500-1:10000 Background Information The receptor for advanced glycation end products (RAGE) is a cell surface transmembrane multiligand receptor, also known as Ager, is a multiligand member of the immunoglobulin superfamily. It has many isoforms and is predominantly expressed in the lung. AGER expression is upregulated in many diseases such as Alzheimer's disease, diabetes mellitus, atherosclerosis, and rheumatoid arthritis (PMID: 35099614). Specification

Tested Reactivity: human, mouse, pig

Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3860 Product name: Recombinant Human AGER/RAGE protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-342 aa of BC020669

Sequence: AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLA

 Predict reactive species Full Name: advanced glycosylation end product-specific receptor Calculated Molecular Weight: 404 aa, 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC020669 Gene Symbol: AGER Gene ID (NCBI): 177 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15109 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.