Iright
BRAND / VENDOR: Proteintech

Proteintech, 85378-1-RR, CLN5 Recombinant monoclonal antibody

CATALOG NUMBER: 85378-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CLN5 (85378-1-RR) by Proteintech is a Recombinant antibody targeting CLN5 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 85378-1-RR targets CLN5 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, HepG2 cells, A549 cells, HEK-293T cells, NIH/3T3 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information The CLN5 (ceroid lipofuscinosis neuronal protein 5) protein is ubiquitously expressed in the majority of tissues studied and in the brain, CLN5 shows both neuronal and glial cell expression. CLN5 plays a role in maintaining an acidic environment in the lysosomes, a critical feature for a functional lysosome (PMID: 38236309). Moreover, CLN5-deficient neuronal progenitor cells showed reduced thioesterase activity, confirming the live cell function of CLN5 in setting S-depalmitoylation levels (PMID: 35427157). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18175 Product name: Recombinant human CLN5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 107-407 aa of BC153154 Sequence: KRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLPTKEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPIRNKTLSGL Predict reactive species Full Name: ceroid-lipofuscinosis, neuronal 5 Calculated Molecular Weight: 407 aa, 46 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC153154 Gene Symbol: CLN5 Gene ID (NCBI): 1203 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75503 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924