Iright
BRAND / VENDOR: Proteintech

Proteintech, 85383-1-RR, ZIP7 Recombinant monoclonal antibody

CATALOG NUMBER: 85383-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ZIP7 (85383-1-RR) by Proteintech is a Recombinant antibody targeting ZIP7 in WB, IHC, ELISA applications with reactivity to human samples 85383-1-RR targets ZIP7 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, A549 cells, K-562 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ZIP7, also known as SLC39A7, is a member of the SLC39 family of zinc transporters. It is a transmembrane protein primarily localized to the endoplasmic reticulum (ER) and is involved in the transport of zinc ions from the ER and Golgi apparatus to the cytoplasm. This process is crucial for maintaining zinc homeostasis within the cell and regulating various signaling pathways. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13798 Product name: Recombinant human SLC39A7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 237-384 aa of BC000645 Sequence: VRHVKGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGPVRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEVPHEVGDFAILVQSGCSKKQAMRLQ Predict reactive species Full Name: solute carrier family 39 (zinc transporter), member 7 Calculated Molecular Weight: 469 aa, 50 kDa Observed Molecular Weight: 45-50 kDa, 56 kDa GenBank Accession Number: BC000645 Gene Symbol: ZIP7 Gene ID (NCBI): 7922 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92504 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924