Proteintech, 85385-1-RR, CD151 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD151 (85385-1-RR) by Proteintech is a Recombinant antibody targeting CD151 in WB, IHC, ELISA applications with reactivity to human samples 85385-1-RR targets CD151 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: 37°C incubated A549 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CD151 (also known as TSPAN24) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are involved in the regulation of cell development, activation, growth and motility. CD151 is broadly expressed by a variety of cell types. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. CD151 enhances cell motility, invasion and metastasis of cancer cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3476 Product name: Recombinant Human CD151 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 113-221 aa of NM_004357.5 Sequence: AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR Predict reactive species Full Name: CD151 molecule (Raph blood group) Calculated Molecular Weight: 28kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: NM_004357.5 Gene Symbol: CD151 Gene ID (NCBI): 977 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P48509 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.