Iright
BRAND / VENDOR: Proteintech

Proteintech, 85389-1-RR, Cas9 Recombinant monoclonal antibody

CATALOG NUMBER: 85389-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Cas9 (85389-1-RR) by Proteintech is a Recombinant antibody targeting Cas9 in WB, ELISA applications with reactivity to n/a samples 85389-1-RR targets Cas9 in WB, ELISA applications and shows reactivity with n/a samples. Tested Applications Positive WB detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Cas9 (CRISPR associated protein 9) is an RNA-guided DNA endonuclease enzyme associated with the CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) adaptive immunity system in Streptococcus pyogenes. This antibody detects the sp Cas9. Specification Tested Reactivity: n/a Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25281 Product name: Recombinant Cas9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-100 aa of NP_269215 Sequence: MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR Predict reactive species Full Name: Cas9 Calculated Molecular Weight: 160 kDa GenBank Accession Number: NP_269215 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924