Iright
BRAND / VENDOR: Proteintech

Proteintech, 85392-2-RR, OAS3 Recombinant monoclonal antibody

CATALOG NUMBER: 85392-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The OAS3 (85392-2-RR) by Proteintech is a Recombinant antibody targeting OAS3 in WB, ELISA applications with reactivity to human samples 85392-2-RR targets OAS3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, LNCaP cells, A549 cells, HeLa cells, HepG2 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The 2-prime,5-prime oligoadenylate synthetases (OASs), such as OAS3, are interferon-induced proteins characterized by their capacity to catalyze the synthesis of 2-prime,5-prime oligomers of adenosine (2-5As). It is also named as p100 OAS and belongs to the 2-5A synthase family. OAS3 is involved in inhibition of cellular protein synthesis and in viral infection resistance. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17411 Product name: Recombinant human OAS3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC113746 Sequence: MDLYSTPAAALDRFVARRLQPRKEFVEKARRALGALAAALRERGGRLGAAAPRVLKTVKGGSSGRGTALKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQVYSTLLNSGCQGGEHAACFTELRRNFVNIRPAKLKNLILLVKHWYHQVCLQGLWKETLPPVYALELLTIFAWEQGCKKDAFSLAEGLRTVLGLIQQHQHLCVFWTVNYGFEDPAVGQFLQRQLKRPRPVILDPADPTWDLGNGAAWHWDLLAQEAASCYDHPCFLRGMGDPVQSWKGPGLPRAGC Predict reactive species Full Name: 2'-5'-oligoadenylate synthetase 3, 100kDa Calculated Molecular Weight: 1087 aa, 121 kDa Observed Molecular Weight: 100-120 kDa GenBank Accession Number: BC113746 Gene Symbol: OAS3 Gene ID (NCBI): 4940 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y6K5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924