Proteintech, 85445-3-RR, PPA1 Recombinant monoclonal antibody

Size: 20ul / 100ul The PPA1 (85445-3-RR) by Proteintech is a Recombinant antibody targeting PPA1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85445-3-RR targets PPA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293T cells, A431 cells, NIH/3T3 cells, C6 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information PPA1(Inorganic pyrophosphatase) is also named as IOPPP, PP and PPase. It maintains the thermodynamic favorability of these reactions by catalyzing the hydrolysis of pyrophosphates into organic phosphates, which are then exported across the cell membrane(PMID:16300924).The erythrocyte inorganic pyrophosphatase molecule would appear to be a dimer(PMID:4130389). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6969 Product name: Recombinant human PPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-289 aa of BC001022 Sequence: MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN Predict reactive species Full Name: pyrophosphatase (inorganic) 1 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC001022 Gene Symbol: PPA1 Gene ID (NCBI): 5464 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15181 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.