Iright
BRAND / VENDOR: Proteintech

Proteintech, 85610-4-RR, PGLYRP1 Recombinant monoclonal antibody

CATALOG NUMBER: 85610-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PGLYRP1 (85610-4-RR) by Proteintech is a Recombinant antibody targeting PGLYRP1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 85610-4-RR targets PGLYRP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human urine Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Peptidoglycan recognition protein 1 (PGLYRP1, also known as PGRP-S) belongs to a family of evolutionary conserved innate immunity proteins, which in mammals also include PGLYRP2, PGLYRP3, and PGLYRP4 (PMID: 17275309; 20418257). PGLYRP1 is highly expressed in polymorphonuclear leukocytes and to a lower extent in many non-immune cells (PMID: 20418257). It recognizes bacterial peptidoglycan and functions in antibacterial immunity and inflammation (PMID: 20418257). PGLYRP1 has been identified as a ligand for TREM-1 (PMID: 25595774). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3122 Product name: Recombinant Human PGLYRP1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-196 aa of NM_005091.2 Sequence: QETEDPACCSPIVPRNEWKALASECAQHLSLPLRYVVVSHTAGSSCNTPASCQQQARNVQHYHMKTLGWCDVGYNFLIGEDGLVYEGRGWNFTGAHSGHLWNPMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQNWPHYRSP Predict reactive species Full Name: peptidoglycan recognition protein 1 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: NM_005091.2 Gene Symbol: PGLYRP1 Gene ID (NCBI): 8993 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75594 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924