Iright
BRAND / VENDOR: Proteintech

Proteintech, 85648-2-RR, ARHGAP4 Recombinant monoclonal antibody

CATALOG NUMBER: 85648-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ARHGAP4 (85648-2-RR) by Proteintech is a Recombinant antibody targeting ARHGAP4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 85648-2-RR targets ARHGAP4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, K-562 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information ARHGAP4 (Rho GTPase-Activating Protein 4), also named as KIAA0131, RGC1, RHOGAP4, is a member of the RhoGAP family, which regulates Rho GTPases by accelerating their hydrolysis of GTP to GDP, thereby inactivating these signaling molecules. Rho GTPases are critical regulators of cytoskeletal dynamics, cell motility, and intracellular trafficking. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10091 Product name: Recombinant human ARHGAP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 714-986 aa of BC052303 Sequence: VALQGRVNQLVQTLIVQPDRVFPPLTSLPGPVYEKCMAPPSASCLGDAQLESLGADNEPELEAEMPAQEDDLEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERASSDWWRGEHNGMRGLIPHKYITLPAGTEKQVVGAGLQTAGESGSSPEGLLASELVHRPEPCTSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH Predict reactive species Full Name: Rho GTPase activating protein 4 Calculated Molecular Weight: 986 aa, 109 kDa Observed Molecular Weight: 115-120 kDa GenBank Accession Number: BC052303 Gene Symbol: ARHGAP4 Gene ID (NCBI): 393 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P98171 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924