Iright
BRAND / VENDOR: Proteintech

Proteintech, 85651-1-RR, IQGAP1 Recombinant monoclonal antibody

CATALOG NUMBER: 85651-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IQGAP1 (85651-1-RR) by Proteintech is a Recombinant antibody targeting IQGAP1 in IHC, IF/ICC, ELISA applications with reactivity to human samples 85651-1-RR targets IQGAP1 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, A431 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19321 Product name: Recombinant human IQGAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 478-827 aa of BC151834 Sequence: QLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRD Predict reactive species Full Name: IQ motif containing GTPase activating protein 1 Calculated Molecular Weight: 189 kDa GenBank Accession Number: BC151834 Gene Symbol: IQGAP1 Gene ID (NCBI): 8826 ENSEMBL Gene ID: ENSG00000140575 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P46940 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924