Proteintech, 85662-6-RR, PLOD1 Recombinant monoclonal antibody

Size: 20ul / 100ul The PLOD1 (85662-6-RR) by Proteintech is a Recombinant antibody targeting PLOD1 in WB, ELISA applications with reactivity to human samples 85662-6-RR targets PLOD1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, HeLa cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information PLOD1, as known as procollagen‐lysine, 2‐oxoglutarate 5‐dioxygenase 1, is a member of the PLOD family(Uniprot, GeneID:5351). PLOD1 participates in catalyzing hydroxylysine residue, which is critical for the formation of covalent cross-link (PMID:30003082). PLOD1 plays an important role in the development and progression of tumors. Aberrantly expressed PLOD1 promotes cancer aggressiveness in glioma and bladder cancer, providing a potential prognostic biomarker and therapeutic target (PMID:31199049, PMID:34040895). PLOD1 has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag31626 Product name: Recombinant human PLOD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 450-564 aa of BC016657 Sequence: YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSNPEDWKEKYIHQNYTKALAGKLVETPCPDVYWFPIFTEV Predict reactive species Full Name: procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1 Calculated Molecular Weight: 727 aa, 84 kDa Observed Molecular Weight: 84-88 kDa GenBank Accession Number: BC016657 Gene Symbol: PLOD1 Gene ID (NCBI): 5351 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q02809 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.