Iright
BRAND / VENDOR: Proteintech

Proteintech, 85671-2-RR, IL-15RA Recombinant monoclonal antibody

CATALOG NUMBER: 85671-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IL-15RA (85671-2-RR) by Proteintech is a Recombinant antibody targeting IL-15RA in WB, ELISA applications with reactivity to mouse, rat samples 85671-2-RR targets IL-15RA in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse small intestine tissue, mouse liver tissue, rat liver tissue, mouse colon tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Interleukin-15 (IL-15) is a pleiotropic cytokine that plays an important role in both innate and adaptive immunity. IL-15 is mainly produced by activated monocytes, macrophages and dendritic cells, and is structurally similar to IL-2 (PMID: 8178155; 12401478). These two cytokines share the same IL-2/15Rβ and common γ-chain receptor subunits. In addition, IL-2 and IL-15 have their own private α-chain receptor subunit, IL-2Rα and IL-15Rα, respectively (PMID: 7641685). The IL-15Rα chain is expressed by many cell types including monocytes, DCs, NK, T cells and fibroblasts. Several isoforms of IL-15Rα exist and are generated either by alternative splicing or by proteolytic cleavage (PMID: 10480910; 15265897). The calculated molecular weight of full-length IL-15Rα is 28 kDa, IL-15Rα can be glycosylated, and larger apparent molecular weights of 55-65 kDa have been reported by some researches (PMID: 10480910; 15976182; 15671076; 17912462). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2687 Product name: Recombinant Mouse IL-15RA protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 33-205 aa of NM_008358.2 Sequence: GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKSDTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSSRAPSLAATMTLEPTASTSLRITEISPHSSKMTK Predict reactive species Full Name: interleukin 15 receptor, alpha chain Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_008358.2 Gene Symbol: Il15ra Gene ID (NCBI): 16169 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q60819-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924