Iright
BRAND / VENDOR: Proteintech

Proteintech, 85684-6-RR, SPINT2/HAI-2 Recombinant monoclonal antibody

CATALOG NUMBER: 85684-6-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SPINT2/HAI-2 (85684-6-RR) by Proteintech is a Recombinant antibody targeting SPINT2/HAI-2 in WB, ELISA applications with reactivity to human samples 85684-6-RR targets SPINT2/HAI-2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, Caco-2 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Serine peptidase inhibitor Kunitz type 2 (SPINT2) is a serine protease inhibitor Kunitz type 2, also known as hepatocyte growth factor (HGF) activator (HGFA) inhibitor type 2 (HAI-2). It displays inhibitory activity in membrane serine proteases, such as matriptase and hepsin, as well as secreted proteases such as HGFA and plasmin (PMID: 9771903, PMID: 15792801). SPINT2 is a tumor suppressor gene that inhibits proteases implicated in cancer progression, like HGFA, hepsin and matriptase (PMID: 30168196). SPINT2 regulates cell proliferation, migration and invasion via a reduction in HGFA, leading to apoptosis and necrosis of uterine leiomyosarcoma cells (PMID: 20664929). This target may exhibit a molecular weight of approximately 28-34 kDa due to glycosylation modification. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3130 Product name: Recombinant Human SPINT2/HAI-2 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 28-197 aa of NM_021102.3 Sequence: ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSK Predict reactive species Full Name: serine peptidase inhibitor, Kunitz type, 2 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28-34 kDa GenBank Accession Number: NM_021102.3 Gene Symbol: SPINT2 Gene ID (NCBI): 10653 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43291-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924