Proteintech, 85714-1-RR, FNIP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The FNIP1 (85714-1-RR) by Proteintech is a Recombinant antibody targeting FNIP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 85714-1-RR targets FNIP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue, human kidney tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Folliculin-interacting protein 1 (FNIP1) forms a complex with the protein folliculin (FLCN), together acting as guanosine triphosphate (GTP)-activating protein (GAP) for RagC. The FNIP1-FLCN complex has emerged as an amino acid sensor to the mechanistic target of rapamycin complex 1 (mTORC1), involved in how amino acids control TFEB activation. AMPK phosphorylation of FNIP1 induces lysosomal and mitochondrial biogenesis (PMID: 37079666) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28976 Product name: Recombinant human FNIP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 163-250 aa of BC001956 Sequence: FTARTGSSICGSLNTLQDSLEFINQDNNTLKADNNTVINGLLGNIGLSQFCSPRRAFSEQGPLRLIRSASFFAVHSNPMDMPGRELNE Predict reactive species Full Name: folliculin interacting protein 1 Calculated Molecular Weight: 508 aa, 57 kDa Observed Molecular Weight: 130-150 kDa GenBank Accession Number: BC001956 Gene Symbol: FNIP1 Gene ID (NCBI): 96459 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8TF40 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.