Iright
BRAND / VENDOR: Proteintech

Proteintech, 85738-1-RR, CXCL4/PF4 Recombinant monoclonal antibody

CATALOG NUMBER: 85738-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CXCL4/PF4 (85738-1-RR) by Proteintech is a Recombinant antibody targeting CXCL4/PF4 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 85738-1-RR targets CXCL4/PF4 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse serum, human peripheral blood platelets, mouse spleen tissue, rat plasma, rat spleen tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Background Information The chemokine (C-X-C motif) ligand 4 (CXCL4) is also named as PF4 (Platelet factor-4) and SCYB4. The platelets, the most abundant source of CXCL4 in vivo, control profibrotic macrophage activation via CXCL4. (PMID: 36807143). Exogenous CXCL4 drove profibrotic activation of monocyte-derived dendritic cells in vitro (PMID: 33042127). Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3345 Product name: Recombinant Mouse CXCL4/PF4 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 30-105 aa of NM_019932 Sequence: VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES Predict reactive species Full Name: platelet factor 4 Calculated Molecular Weight: 11kd Observed Molecular Weight: 10-14 kDa GenBank Accession Number: NM_019932 Gene Symbol: Pf4 Gene ID (NCBI): 56744 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Z126 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924