Proteintech, 85759-4-RR, TIPE2/TNFAIP8L2 Recombinant monoclonal antibody

Size: 20ul / 100ul The TIPE2/TNFAIP8L2 (85759-4-RR) by Proteintech is a Recombinant antibody targeting TIPE2/TNFAIP8L2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85759-4-RR targets TIPE2/TNFAIP8L2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: THP-1 cells, HL-60 cells, RAW 264.7 cells, mouse spleen tissue, rat spleen tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information TIPE2 (TNF-α-inducible protein 8-like 2, or TNFAIP8L2), a negative immune regulator, is essential for maintaining immune homeostasis. TIPE2 shares considerable sequence homology with members of the tumor necrosis factor-α-inducible protein 8 (TNFAIP8) family, which are thought to regulate cellular and immune homeostasis. TIPE2 acts as a negative regulator of Toll-like receptor and T-cell receptor function and is preferentially expressed in lymphoid tissues. TIPE2 plays an essential role in a signal transduction pathway that links the inflammatory immune response to specific conditions after cerebral ischemia Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7964 Product name: Recombinant human TNFAIP8L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC063014 Sequence: MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL Predict reactive species Full Name: tumor necrosis factor, alpha-induced protein 8-like 2 Calculated Molecular Weight: 184 aa, 21 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC063014 Gene Symbol: TIPE2 Gene ID (NCBI): 79626 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6P589 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.